PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01009128001
Common NameVITISV_035994
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ZF-HD
Protein Properties Length: 247aa    MW: 27609.3 Da    PI: 9.4015
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01009128001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.23.4e-32102157359
        ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                        + rY+eClkNhA+ +GghavDGCgEfmp+ g+egt ++l+CaAC+CHRnFHR+e+e 
  GSVIVT01009128001 102 NSRYRECLKNHAVGIGGHAVDGCGEFMPA-GDEGTLDGLRCAACNCHRNFHRKESEG 157
                        579*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-2491156IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.1E-29103155IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-29104154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.418105154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.79E-19178244IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-32178245IPR009057Homeodomain-like
TIGRFAMsTIGR015652.1E-24183239IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MASMLAANGA KTPAITGKPK AKKWGWVEGK RGHNLSFRNG KHMKTFQVEK VETEMEFEEH  60
EEQEEDMGMA VQASYESVGN TGRPKMGSGG GEGASTVRKV GNSRYRECLK NHAVGIGGHA  120
VDGCGEFMPA GDEGTLDGLR CAACNCHRNF HRKESEGDTL YHQFSPYYRT PAGYLHVAPS  180
HLKKRFRTKF TQEQKDKMLA FAETLGWRIQ KHDEAAVQQF CQETCVKRHV LKVWMHNNKH  240
TLGKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-271842411875ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.296270.0inflorescence
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4767120.0AM476712.2 Vitis vinifera contig VV78X131483.10, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002285709.11e-127PREDICTED: zinc-finger homeodomain protein 1
SwissprotQ9SB613e-67ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA5BZD71e-165A5BZD7_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g07140.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.15e-67homeobox protein 22